PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462932636
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family TALE
Protein Properties Length: 647aa    MW: 71792.8 Da    PI: 6.0679
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462932636genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.45.7e-094074441954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yp+ +e+  LA+++gLt +q+++WF N R +
  462932636 407 FEHflHPYPKDSEKLMLARQTGLTRSQISNWFINARVR 444
                665559******************************88 PP

2BELL119.12e-38270341172
       BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                e+qelq+k akL+ +l+eVd++Yk+y++q+qtv+ssF++vag g+akpYt++Al++iSrhFrcLkdai +qi
  462932636 270 EKQELQNKMAKLMAMLDEVDRKYKHYYHQMQTVVSSFDVVAGPGAAKPYTAVALHTISRHFRCLKDAINDQI 341
                689*******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005749.1E-58194339IPR006563POX domain
PfamPF075263.3E-51200337IPR006563POX domain
PROSITE profilePS5007112.325385448IPR001356Homeobox domain
SMARTSM003893.6E-9388452IPR001356Homeobox domain
CDDcd000863.77E-12388449No hitNo description
SuperFamilySSF466892.82E-17389454IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.8E-28391454IPR009057Homeodomain-like
PfamPF059201.0E-17405444IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 647 aa     Download sequence    Send to blast
MATYYSSPGT ERDSQNMYSR DPGGASYPMP SALGNLLYLN NPTSGPYTEF SGILQSQQNC  60
MEIPDPGHPS VMSQDSSARE SDMLGSHQGQ HSFNSVKDMK NEMLMHMMDG SQSSTANLIH  120
DDAHNGAQLE FGVLNNHSPS NVHSVQGQGL SLSLNTQILA PSLPYWSIKP DMLSPQSYHD  180
SLRVDDIRMK SMQSEASRAI RNSRYLKAAQ ELLDEVVNVW KNIKQKAQKE QGDAGKADGK  240
ENEGGPKSEG VSSNPQESAA NTAPELSTAE KQELQNKMAK LMAMLDEVDR KYKHYYHQMQ  300
TVVSSFDVVA GPGAAKPYTA VALHTISRHF RCLKDAINDQ INVIRRKLGE EENSSGKEGK  360
LTRLRYIDQQ LRQQRAFQQY GMIPQNAWRP QRGLPENSVT ILRAWLFEHF LHPYPKDSEK  420
LMLARQTGLT RSQISNWFIN ARVRLWKPMI EDMYKEEIGD IEQDSNSSSD NAPRSKAEVA  480
SSEDKEGLKS STPRVCETSQ LSESRASIGT VNVGGAPVGF QNEANPDESF MNLMLKDQRS  540
NDTDGGLLLH NAVAHHPDEN ARFMAYHLAE LGRYGNGNVS LTLGLQHSSS SLSVPNAQQS  600
FPGVGDDIYN ATAPLGASVA SSDYESMNQM DQRQRFEQSP LLHDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B3e-16394451158Homeobox protein Meis1
4xrs_A3e-16394451158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963321.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_004963320.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_004963319.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLK3Z4G80.0K3Z4G8_SETIT; Uncharacterized protein
STRINGSi021436m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90138131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-113BEL1-like homeodomain 6